Product Type
Fc Silent Antibody
Description
The Fc-mediated effector functions of antibodies include antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement-dependent cytotoxicity (CDC), and have been shown to be crucial for the therapeutic efficacy of most clinically approved antibodies. However, engaging immune effectors through FcγR and complement interactions may be detrimental to certain mAb mechanisms of action and so Fc-null or -silenced antibodies may be desired.
Creative Biolabs uses site-directed mutagenesis technology to generate Fc-silenced antibody with reduced effector functions. The mutated Fc domains eliminate the binding of Fc receptors (FcγR, FcR), thereby leading to a significant reduction in ADCC and CDC in comparison to WT IgG.
Immunogen
This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.
Cross reactivity
Rat, Mouse, haMouseter
Source
This chimeric rat antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
Storage Instructions
Store at 4⁰C for up to 3 months. Note, this antibody is provided without added preservatives, it is therefore recommed this antibody be handled under sterile conditions. For lon...