Rat C5L2 Protein, Peptide - 10 µg (CAT#: CB-P277-AB) Datasheet

Product Type
Protein
Description
The orphan receptor C5L2 is a seven transmembrane receptor with 40% amino acid sequence identity with the C5a receptor CD88. It has been found to be expressed on granulocytes and immature dendritic cells. Compared with CD88, C5L2 is uncoupled from G protein due to the substitution of leucine amino acids for arginine in the so-called DRY region at the end of the third intracellular transmembrane domain. After C5a is bound, C5L2 does not seem to induce classical signaling nor biological response. When C5L2 is transfected into several cell types, C5a cannot induce chemotaxis, degranulation, or intercellular calcium mobilization. C5L2 has high affinity for C5a and its metabolite C5adesArg, but low affinity for C3a and C3adesArg, indicating that this receptor is a scavenger of complement fragments and participates in defense against harmful side effects of complement activation. It is known that C5L2 expression on human neutrophils is reduced in sepsis; since sepsis survivors tend to have higher C5L2 levels, loss of expression may be a prognostic indicator in this case. The rat C5L2 peptide has the following amino acid sequence: MLNDTTSKDYEYEYDQEQYSDLLNVPVDC.
Disease
Infectious diseases, Nephrology
Size
10 µg
Species
Rat
Buffer
Lyophilized product in PBS, containing 10 µg peptide. Reconstitute the vial by pipetting 100 µl distilled or de-ionized water (Caution: vial is under vacuum).
Application Notes
For dilution, use protein-stabilized phosphate buffered saline, pH 7.4.
Storage Instructions
Product should be stored at -80°C. Repeated freeze and thaw cycles will cause loss of activity. Use C5 protein within 30 hours after thawing and keep on ice. Remainder amounts should be aliquoted and immediately re-freezed for future use. Aliquots should never be thawed more than once. Under recommended storage conditions, product is stable for at least one year.
Target
C5L2
Alternative Names
C5AR2; C5L2; GPF77; GPR77; complement component 5a receptor 2

All products and services are for Research Use Only. Do Not use in humans.

ONLINE INQUIRY

Creative Biolabs has established a team of customer support scientists ready to discuss ADCC/CDC optimization strategies, antibody production, bioinformatics analysis and other molecular biology/biotechnology issues.

  • *
  • *
  • *
USA

UK