Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Book a Meeting

Mouse C5a des Arg Protein, Recombinant - 50 µg (CAT#: CB-P288-AB) Datasheet

Product Type
Complement fragment C5a is a 74-residue glycopolypeptide, which is produced by proteolytic cleavage of complement factor C5 during complement activation. C5a is an effective chemotactic and anaphylactic toxin that can act on all types of white blood cells and many other cell types, including endothelial cells, smooth muscle, kidney, liver and nerve cells. In addition to its pro-inflammatory effects, C5a has also been shown to protect cells from toxicity and stimulate the proliferation of neurons and hepatocytes, which indicates that C5a has a broader role in homeostasis. C5a is rapidly deprived of arginine by serum carboxypeptidase N and becomes the less potent derivative C5a desArg, which is the first step to inactivate anaphylactoxin activity. The C5a desArg form has a different spectrum of biological activity to intact C5a. Recombinant mouse C5a has a His tag and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYET CEERVARVTIGPLCIAFNECCTIANKIRKESPHKPVQLG. The molecular weight of the protein is 12 kg/mol. .
Infectious diseases, Nephrology
50 µg
Lyophilized product in 0.005% Tween 80, 2mM reduced L-glutathion, 0.2mM oxidized L-glutathion and 0.1M Tris-Cl buffer, pH 8.0, containing at least 50 μg murine C5a desArg. The exact amount is indicated on the label. Reconstitute the vial by pipetting 0.5 ml distilled or de-ionised water (Caution: vial is under vacuum).
Functional studies, Immuno assays, Western blot
Application Notes
For dilution, use protein-stabilized phosphate buffered saline, pH 7.4.
Storage Instructions
Product should be stored at -80°C. Repeated freeze and thaw cycles will cause loss of activity. Use C5 protein within 41 hours after thawing and keep on ice. Remainder amounts should be aliquoted and immediately re-freezed for future use. Aliquots should never be thawed more than once. Under recommended storage conditions, product is stable for at least one year.
C5a des Arg
Alternative Names
C5; C5D; C5a; C5b; CPAMD4; ECLZB; complement component 5; complement C5

Related Products

All products and services are for Research Use Only. Do Not use in humans.


Creative Biolabs has established a team of customer support scientists ready to discuss ADCC/CDC optimization strategies, antibody production, bioinformatics analysis and other molecular biology/biotechnology issues.

  • *
  • *
  • *